Everything below concerns thymosin beta-4. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-10-07. Numbers and descriptions here follow the published literature rather than marketing material.
The peptide lacks cysteine, methionine, and tryptophan, so disulfide scrambling and sulfur oxidation are not major degradation routes. Instead, aspartate residues can undergo isomerization or cyclization to succinimide intermediates, generating isoaspartate variants. Hydrolysis of peptide bonds also occurs slowly in solution. These changes may reduce biological activity even when the main peak remains detectable. Stability studies therefore track both potency and the appearance of related substances.
Lyophilized thymosin alpha 1 is typically stored refrigerated at 2 to 8 degrees Celsius and kept away from light. Reconstituted solutions are less stable and are usually used promptly after preparation. Repeated freeze-thaw cycles are avoided because they can promote aggregation and loss of activity. The peptide adsorbs to some plastic and glass surfaces, so a carrier protein is often added to dilute working solutions. Manufacturer instructions and published protocols both govern handling.
Clinical research has examined the peptide in chronic hepatitis B and C, as a vaccine adjuvant, and in sepsis and oncology settings. Results across trials have been mixed, and several studies were small or conducted under differing protocols. Regulatory status varies by country, and the compound is not approved in every jurisdiction where it is studied. Evidence for any single indication should be read with attention to sample size and endpoint choice.
Thymosin alpha-1 is a 28-residue peptide first isolated from thymus tissue in the 1970s. It corresponds to the N-terminal portion of thymosin beta-4, from which it is cleaved in vivo. The peptide carries an acetyl group at its N-terminus, a modification that affects its charge and stability. Synthetic material produced by solid-phase peptide synthesis is chemically identical to the natural fragment and is the form used in research and clinical studies.
Laboratory work indicates that the peptide acts on cells of both the innate and adaptive immune systems. Reported effects include signalling through Toll-like receptors on dendritic cells, enhanced T-cell maturation, and increased natural killer cell activity. These actions are described largely from cell-culture and animal experiments, and the precise receptor-level events remain incompletely defined. Studies in humans have generally measured immune markers rather than a single defined molecular target. The resulting picture remains partly descriptive.
| Property | Value | Notes |
|---|---|---|
| Physical form | Lyophilized powder | Reconstituted before use |
| Typical storage | 2-8 °C, protected from light | Applies to the powder |
| Reconstitution solvent | Sterile water or saline | Follow product labeling |
| Solution stability | Shorter than the powder | Refrigerate and use promptly |
| Primary purity method | Reversed-phase HPLC | Detects related substances |
Identity and purity are usually checked by reverse-phase high-performance liquid chromatography, which separates the intact chain from truncated products, together with mass spectrometry for confirmation of the expected mass. Peptide mapping after enzymatic digestion and amino acid analysis add sequence-level evidence. Release testing also covers water content, residual solvents, and counter-ions, all of which influence measured mass and stability. Related-peptide limits are commonly expressed as a percentage of total peak area, with individual unspecified impurities held below a lower threshold.
The lyophilized peptide is a white to off-white powder that dissolves freely in water and in aqueous buffers near neutral pH. Because the molecule carries a net negative charge under physiological conditions, saline and phosphate solutions are the usual vehicles, while strongly acidic media are avoided. Stock solutions are commonly divided into small aliquots so that repeated freezing and thawing can be limited, since cycling may encourage aggregation. Solubility in organic solvents is poor and those solvents are seldom used as primary diluents.
Recommended storage for the dry powder is a freezer near minus twenty degrees Celsius, kept desiccated and away from light. Once dissolved, the peptide is less stable and is usually held at two to eight degrees Celsius for short intervals or frozen for longer storage. Stability studies focus on the acetylated terminus and the disulfide linkage because those features define the intact molecule. Common degradation routes include cysteine oxidation, deamidation of asparagine or glutamine side chains, and slow formation of higher-molecular-weight species.
Biologically, the peptide is studied mainly in the context of immune cell development and regulation. It is produced in the thymus and in several other tissues, and it appears to influence the maturation and activity of T cells and other immune populations. Laboratory work describes effects on cytokine production, on the balance between T cell subsets, and on the function of dendritic cells. Much of this evidence comes from cell culture and animal models, so the extent to which the same pathways operate in humans remains an open question.
Clinical interest has centered on chronic viral hepatitis, on immune restoration in various conditions, and on use as an adjuvant intended to improve responses to vaccines. Trials have reported mixed results, and regulatory status differs sharply between countries; in some places it is a prescription product, while elsewhere it is sold without an approved therapeutic indication. Because published studies vary widely in design, population, and endpoints, comparisons across them are difficult and no single conclusion covers the whole literature.
Thymosin alpha 1 is a short peptide of 28 amino acid residues that derives from the amino terminal region of a larger precursor protein known as prothymosin alpha. The peptide carries an acetyl group on its first residue and contains no disulfide bonds or carbohydrate chains. Its sequence is highly conserved across mammalian species, which is one reason laboratories treat it as a molecule with a defined and reproducible structure rather than a variable tissue extract. The name follows an early naming convention for thymus-derived fractions and does not imply that the peptide acts as a hormone in the classical endocrine sense.
The compound has been investigated as an adjunct in chronic viral hepatitis and as a vaccine adjuvant, with results that vary by study design and population. Regulators in some countries have approved a synthetic form for specific indications, while other agencies have not. Whether the peptide produces consistent clinical benefit across diverse patient groups is still an open question, and many trials have been small. Its status is therefore best described as investigational in many contexts and established only narrowly.
The name itself causes confusion, because several unrelated thymic peptides share the thymosin label. Thymosin beta-4, for example, is a different molecule with different functions. Naming conventions in the literature also mix descriptive research terms with assigned nonproprietary names, so a reader should confirm which entity a given paper addresses. Clarifying that point is usually the first step in interpreting any claim about this peptide.
Bexlosteride is a potent and noncompetitive inhibitor of the enzyme 5α-reductase related to finasteride and dutasteride. It is selective for the type I isoform of the enzyme. It advanced to Phase III clinical trials, but development was halted at that stage, and it was never marketed.
CH stations were designed to operate at 20–50 MHz, the "boundary area" between high frequency and VHF bands at 30 MHz, although typical operations were at 20–30 MHz (the upper end of the HF band), or about a 12 m wavelength (25 MHz). The detection range was typically 120 mi (190 km; 100 nmi), but could be better. The main limitation in use was that Chain Home was a fixed system, non-rotational, which meant it could not see beyond its sixty-degree transmission arc or behind it once the targets had flown overhead, and so raid plotting over land was down to ground observers, principally the Observer Corps (from April 1941 known as the Royal Observer Corps). Ground-based observation was acceptable during the day but useless at night and in conditions of reduced visibility. This problem was lessened on introduction of more advanced surveillance radars with 360-degree tracking and height-finding capability and, more importantly, aircraft fitted with Airborne Intercept radar (AI), which had been developed in parallel with Chain Home from 1936 onwards. This new equipment began to appear in late 1940 fitted to Bristol Blenheim, Bristol Beaufighter and Boulton Paul Defiant aircraft. Even as the CH system was being deployed, a wide variety of experiments with newer designs was being carried out. By 1941 the Type 7 Ground Control Intercept Radar (GCI) on a wavelength of 1.5 m was entering production, and reached widespread service in 1942.
== Mechanism of action == There are several proposed mechanisms of how solanine causes toxicity in humans, but the true mechanism of action is not well understood. Solanum glycoalkaloids have been shown to inhibit cholinesterase, disrupt cell membranes, and cause birth defects. One study suggests that the toxic mechanism of solanine is caused by the chemical's interaction with mitochondrial membranes. Experiments show that solanine exposure opens the mitochondrial permeability transition pores of the inner mitochondrial membrane, decreasing the membrane potential. The opening of these pores leads to Ca2+ being transported from the mitochondria into the cytoplasm, and this increased concentration of Ca2+ in the cytoplasm triggers cell damage and apoptosis. Potato, tomato, and eggplant glycoalkaloids like solanine have also been shown to affect active transport of sodium across cell membranes. This cell membrane disruption is likely the cause of many of the symptoms of solanine toxicity, including burning sensations in the mouth, nausea, vomiting, abdominal cramps, diarrhea, internal hemorrhaging, and stomach lesions.
Norris was born and brought up in the Milton area of Glasgow, Scotland. He originally worked as a travel agent after leaving college, but after a few years in this role decided to retrain as a nurse. Friends described him as someone who loved being centre stage, and said he enjoyed amateur dramatics. His academic record was average, but he became known for being quick to anger and his aggressive confrontations with tutors and, later, employers. His behaviour towards university lecturers at the University of Dundee was described as "unacceptable". He constantly argued with his tutor, later saying that she "and I didn't exactly see eye to eye. I had a personality clash, basically 'cos I had one and she never, and she was my personal tutor." Shortly before he qualified, this tutor was known to have taught Norris about Jessie McTavish, a nurse convicted of murdering a patient with insulin at Ruchill Hospital in Glasgow, less than a mile from where Norris grew up. McTavish's conviction was overturned on appeal. Norris was then tasked with "reviewing" her conduct by the tutor. Learning about McTavish would later be regarded as a likely inspiration for Norris, and he would have believed at this point that insulin would be the "perfect" weapon for murder as it leaves the blood very quickly. Norris began working at Leeds General Infirmary after qualifying in June 2001, but quickly fell out with experienced authority figures, finding it difficult to be told 'no' or what to do.
Norepinephrine is the main neurotransmitter used by the sympathetic nervous system, which consists of about two dozen sympathetic chain ganglia located next to the spinal cord, plus a set of prevertebral ganglia located in the chest and abdomen. These sympathetic ganglia are connected to numerous organs, including the eyes, salivary glands, heart, lungs, liver, gallbladder, stomach, intestines, kidneys, urinary bladder, reproductive organs, muscles, skin, and adrenal glands. Sympathetic activation of the adrenal glands causes the part called the adrenal medulla to release norepinephrine (as well as epinephrine) into the bloodstream, from which, functioning as a hormone, it gains further access to a wide variety of tissues. Broadly speaking, the effect of norepinephrine on each target organ is to modify its state in a way that makes it more conducive to active body movement, often at a cost of increased energy use and increased wear and tear. This can be contrasted with the acetylcholine-mediated effects of the parasympathetic nervous system, which modifies most of the same organs into a state more conducive to rest, recovery, and digestion of food, and usually less costly in terms of energy expenditure. The sympathetic effects of norepinephrine include:
Sources: en.wikipedia.org
=== US rationale === The Trump administration did not initially announce any specific legal authority for the first strike. Secretary of Defense Pete Hegseth declared, "We have the absolute and complete authority", citing "... the defense of the American people alone. 100,000 Americans were killed each year under the previous administration because of an open border and open drug traffic flow. That is an assault on the American people." Regarding the initial strike, the Trump administration did not provide evidence about the vessel's cargo, nor did it establish that the vessel's crew were threatening to attack. Trump was questioned on 5 September about the legality of the first strike, to which he responded: "We don't want drugs killing our people. I believe we lost 300,000 ... last year"—a number he repeated days later in an Oval Office meeting. Drug overdose deaths in the US in 2024 were about 80,000 according to the US Centers for Disease Control and Prevention, representing a 25 percent decline from the previous year deaths of 112,910. When speaking impromptu to reporters prior to boarding Air Force One on 14 September, Trump inflated that number to 300 million. CNN states that "allegations involving [Venezuela's] presidential palace in cocaine trafficking have existed for at least a decade." Former US Attorney General William Barr first accused Maduro of supporting drug trafficking in 2020, stating that 250 tons of cocaine are smuggled through Venezuela annually, facilitated by the government, although no evidence was presented.
=== Aromatic hydrocarbons === Aromatic hydrocarbons show distinct molecular ion peak.benzylic cleavage is pretty common. When alkyl groups are attached to the ring, a favorable mode of cleavage is to lose a H-radical to form the tropylium cation (m/z 91).
Less than truckload (LTL) cargo is the first category of freight shipment, representing the majority of freight shipments and the majority of business-to-business (B2B) shipments. LTL shipments are also often referred to as motor freight and the carriers involved are referred to as motor carriers. LTL shipments range from 50 to 7,000 kg (110 to 15,430 lb), being less than 2.5 to 8.5 m (8 ft 2.4 in to 27 ft 10.6 in) the majority of times. The average single piece of LTL freight is 600 kg (1,323 lb) and the size of a standard pallet. Long freight and/or large freight are subject to extreme length and cubic capacity surcharges. Trailers used in LTL can range from 28 to 53 ft (8.53 to 16.15 m). The standard for city deliveries is usually 48 ft (14.63 m). In tight and residential environments the 28 ft (8.53 m) trailer is used the most. The shipments are usually palletized, stretch [shrink]-wrapped and packaged for a mixed-freight environment. Unlike express or parcel, LTL shippers must provide their own packaging, as carriers do not provide any packaging supplies or assistance. However, circumstances may require crating or another substantial packaging.
=== March === March 2, 2010: Canada The economy is rocketing further away from recession, increasing the chances that the Bank of Canada will lift borrowing costs more aggressively than expected later this year. Economic growth surged an annualized 5% in the fourth quarter, providing the clearest sign yet that a broad-based recovery is taking firm hold. It was the fastest annualized quarterly growth since 2000, and the first solidly positive quarter since the economy entered recession in 2008 amid a global pullback brought on by the 2008 financial crisis. The fourth-quarter surge was fuelled by everything from a strong housing sector and healthy consumer spending to a surprise turnaround for net trade as the country's exports grew at almost double the pace of imports, according to Statistics Canada.
== Traditional and alternative uses == The medicinal uses of insects and other arthropods worldwide have been reviewed by Meyer-Rochow, who provides examples of all major insect groups, spiders, worms and molluscs and discusses their potential as suppliers of bioactive components. Using insects (and spiders) to treat various maladies and injuries has a long tradition and, having stood the test of time, can be effective and provide results. However, sometimes folk-medicinal "logic" was based on the Doctrine of Signatures ("let likes be cured by likes") and had, if any at all, little more than a psychological effect. For example, to treat cases of constipation, dung beetles were prescribed; to slim down stick insects were thought to help; hairy tarantulas seemed the right treatment for hair loss and fat grubs resembling the swollen limb caused by the parasite Wuchereria bancrofti were expected to help the elephantiasis patient. An organism bearing parts that resemble human body parts, animals, or other objects, was thought to have useful relevance to those parts, animals or objects. So, for example, the femurs of grasshoppers, which were said to resemble the human liver, were used to treat liver ailments by the indigenous peoples of Mexico. This doctrine is common throughout traditional and alternative medicine, but is most prominent where medical traditions are broadly accepted, as in traditional Chinese medicine and Ayurveda, and less by community and family based medicine, as is more common in parts of Africa.
Sources: en.wikipedia.org
Healthy white male volunteers were selected as the typical skin lesions were easier to see in Caucasians and this population was felt to be those least susceptible to the disease, thus provide the strongest evidence that the disease was caused by a nutritional deficiency. Subjects experienced mild, but typical cognitive and gastrointestinal symptoms, and within five months of this cereal-based diet, 6 of the 11 subjects broke out in the skin lesions that are necessary for a definitive diagnosis of pellagra. The lesions appeared first on the scrotum. Goldberger was not given the opportunity to experimentally reverse the effects of diet-induced pellagra, as the prisoners were released shortly after the diagnoses of pellagra were confirmed. In the 1920s, he connected pellagra to the corn-based diets of rural areas rather than infection as contemporary medical opinion would suggest. Goldberger believed that the root cause of pellagra amongst Southern farmers was limited diet resulting from poverty, and that social and land reform would cure epidemic pellagra. His reform efforts were not realized, but crop diversification in the Southern United States, and the accompanying improvement in diet, dramatically reduced the risk of pellagra. Goldberger is remembered as the "unsung hero of American clinical epidemiology". Though he identified that a missing nutritional element was responsible for pellagra, he did not discover the specific vitamin responsible.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
The ion extraction efficiency (β) can be optimized by increasing the voltage of both repeller and acceleration. Since the ionization cross section depends on the chemical nature of the sample and the energy of ionizing electrons a standard value of 70 eV is used. At low energies (around 20 eV), the interactions between the electrons and the analyte molecules do not transfer enough energy to cause ionization. At around 70 eV, the de Broglie wavelength of the electrons matches the length of typical bonds in organic molecules (about 0.14 nm) and energy transfer to organic analyte molecules is maximized, leading to the strongest possible ionization and fragmentation. Under these conditions, about 1 in 1000 analyte molecules in the source are ionized. At higher energies, the de Broglie wavelength of the electrons becomes smaller than the bond lengths in typical analytes; the molecules then become "transparent" to the electrons and ionization efficiency decreases. The effective ionizing path length (L) can be increased by using a weak magnetic field. But the most practical way to increase the sample current is to operate the ion source at higher ionizing current (Ie).
=== Polling === In October, before the strikes, a poll by AtlasIntel showed that approximately 64% of Venezuelans abroad support US military intervention to depose Maduro, compared with 34% within Venezuela. In December, a poll by Datanalisis found that 55% of Venezuelans opposed foreign military intervention while 23% supported it. After the strikes, a poll by Reuters surveying 1,248 adults in the United States found that 33% of Americans approved of the military action, while 34% did not; 65% of Republicans supported the action compared to 11% of Democrats, and 72% of Americans were concerned that the US would get too involved in Venezuela, including 54% of Republicans. The same poll showed that Trump approval ratings rose to 42% after the attack, the highest rating since October 2025, when his approval rating was 39%. A poll was made by The Economist on 9 January, surveying 600 Venezuelan residents of different ages and sex to reflect the national population. Most respondents were positive about the intervention, only 13% of respondents mildly opposed the capture of Maduro. The 18% of respondents oppose United States governance in Venezuela. Most respondents want a quick change of government, with 43% supporting María Corina Machado as the leader and 13% supporting Delcy Rodríguez. The 91% of respondents answering in support for a change of government within a year.
Sources: en.wikipedia.org
The lyophilized powder is kept refrigerated at 2 to 8 degrees Celsius and protected from light. Reconstituted solutions should be used promptly. Freezing and thawing repeatedly is avoided.
Reversed-phase HPLC is the primary tool for purity, paired with mass spectrometry for identity. Amino acid analysis and peptide mapping add sequence confirmation. Several techniques are combined because no single test covers every attribute.
It lacks sulfur-containing residues, so oxidation is limited. Aspartate isomerization and slow hydrolysis are the main concerns. Solution stability is shorter than that of the lyophilized powder.
It corresponds to the first 28 amino acids of thymosin beta-4, a larger protein found in many tissues. The fragment is acetylated at its N-terminus and is produced synthetically for research and pharmaceutical use. Synthetic and natural forms share the same sequence.