If you have been reading about clinical endpoint and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-04-19. Numbers and descriptions here follow the published literature rather than marketing material.
Reverse-phase high-performance liquid chromatography is the standard technique for assessing purity and concentration, because the peptide's hydrophobicity allows clean separation from related impurities. Mass spectrometry confirms molecular identity and detects sequence errors or truncations. Amino acid analysis and peptide mapping supply additional structural confirmation when required. Chromatographic purity values reported on certificates of analysis describe the proportion of the main peak and do not by themselves establish biological activity.
Like most short peptides, thymosin alpha-1 is susceptible to hydrolysis under strongly acidic or basic conditions and to oxidation when exposed to air over long periods. The acetylated amino terminus blocks one common degradation route, which contributes to the molecule's relative robustness in solution. Lyophilized material generally retains potency for extended periods when kept cold and dry. Once reconstituted, aqueous solutions are less stable and are typically used within a defined window rather than held indefinitely at ambient temperature.
The molecule consists of 28 amino acid residues with an acetyl group attached to the N-terminal serine. Its sequence is acidic overall, with several glutamic and aspartic acid residues distributed along the chain and no cysteine, so disulfide bridges do not form. The peptide carries a net negative charge at physiological pH. Because the N-terminus is blocked, the intact molecule resists degradation by many aminopeptidases, which contributes to its stability in biological fluids.
The peptide is generated in cells by cleavage of prothymosin alpha, a larger acidic protein encoded by the PTMA gene. Prothymosin alpha is expressed in many tissues, not only in the thymus, and its functions include nuclear roles in chromatin-related processes. The 28-residue fragment corresponds to the N-terminal portion of that precursor. How the cleavage occurs and how the fragment's concentration is regulated remain open questions; circulating amounts are small and difficult to measure reliably with routine assays.
| Property | Value | Notes |
|---|---|---|
| Primary structure | 28 amino acid residues | N-terminally acetylated |
| Net charge at neutral pH | Negative | Acidic peptide |
| Typical purity assay | Reverse-phase HPLC | UV detection near 214 nm |
| Identity confirmation | Mass spectrometry | Matches expected molecular mass |
| Reconstitution solvent | Sterile water or saline | Follow supplier instructions |
The compound has been investigated as an adjunct in chronic viral hepatitis and as a vaccine adjuvant, with results that vary by study design and population. Regulators in some countries have approved a synthetic form for specific indications, while other agencies have not. Whether the peptide produces consistent clinical benefit across diverse patient groups is still an open question, and many trials have been small. Its status is therefore best described as investigational in many contexts and established only narrowly.
The name itself causes confusion, because several unrelated thymic peptides share the thymosin label. Thymosin beta-4, for example, is a different molecule with different functions. Naming conventions in the literature also mix descriptive research terms with assigned nonproprietary names, so a reader should confirm which entity a given paper addresses. Clarifying that point is usually the first step in interpreting any claim about this peptide.
Lyophilized material is typically treated as a hygroscopic solid that should be brought to room temperature before the container is opened, which limits condensation on the powder. Reconstitution is commonly done with sterile water or a buffered diluent, and gentle mixing is preferred over vigorous agitation to reduce foaming and surface adsorption. Because peptides can bind to plastic and glass, diluents containing a small amount of carrier protein are sometimes used in laboratory work. Working solutions are generally aliquoted and prepared fresh rather than subjected to repeated freezing and thawing.
Stability depends on temperature, pH, and the number of freeze-thaw events the sample has experienced. Freeze-dried material is commonly held at -20 °C or colder, while reconstituted liquid is kept cold and used within a short window. Extreme pH and prolonged light exposure can promote deamidation, oxidation, or aggregation, particularly at asparagine and methionine positions. Adsorption to container walls can lower the measured concentration of a dilute solution even when the peptide molecules themselves remain intact.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated or chemically modified byproducts. Mass spectrometry confirms the expected molecular mass and can indicate acetylation state or sequence errors. Amino acid analysis and peptide mapping supply complementary sequence-level information, while endotoxin testing is relevant for preparations intended for cell or animal work. Purity figures reported by suppliers refer to the method used and are not directly comparable across laboratories unless conditions are stated.
Several names appear in the literature for this peptide, including thymalfasin and the abbreviation T-alpha-1. Naming conventions differ among research articles, regulatory documents, and supplier catalogs, which complicates literature searches. Both synthetic and recombinant production routes yield a peptide with the same 28-residue sequence as the thymic isolate. Because the thymosin label also covers unrelated peptides, sources should be compared by sequence rather than by name alone.
The peptide occurs naturally in thymic tissue and has been detected in serum and other biological fluids. Reported concentrations are low, and reliable measurement generally requires immunoassay or mass spectrometry with an enrichment step. It is released from a larger precursor, prothymosin alpha, by proteolytic cleavage, although the enzymes involved are not fully characterized. Whether circulating levels reflect thymic output specifically remains an open question.
Thymosin alpha 1 was identified in 1977 as a component of thymosin fraction 5, a heterogeneous preparation used in early studies of thymic function. Investigators purified the active material and determined its amino acid sequence, which enabled chemical synthesis. Work in the following decades concentrated on T-cell maturation and immune reconstitution in animals and small human cohorts. Early preparations varied in composition, so results from that period are difficult to compare with studies using defined synthetic peptide.
Clinical research has examined the peptide in chronic hepatitis B and C, as a vaccine adjuvant, and in sepsis and oncology settings. Findings across trials are mixed; some report changes in selected immune markers, while others find no clear clinical benefit. Many studies are small and define outcomes differently, which limits comparison. Regulatory approval is confined to a few countries, and the compound is not an approved drug in the United States or most of Europe.
Overall evidence quality varies considerably. A large share of published reports come from single centers, rely on surrogate immunological markers, or lack adequate control groups. Systematic reviews have highlighted this heterogeneity as a barrier to pooling results. Open questions include which patients, if any, might benefit, what treatment duration is appropriate, and whether any effect is independent of standard care. The peptide is often described as an immune modulator rather than a therapy for one disease, which complicates confirmatory trial design.
A typical APCI source usually consists of three main parts: a sample inlet, a corona discharge needle, and an ion transfer region under intermediate pressure. In the case of the heated nebulizer inlet from an LC, as shown in the figure, the eluate flows at 0.2 to 2.0 mL/min into a pneumatic nebulizer which creates a mist of fine droplets. Droplets are vaporized by impact with the heated walls at 350–500 °C and carried by the nebulizer gas and an auxiliary gas into the ion molecule reaction region between the corona electrode and the exit counter-electrode. A constant current of 2–5 microamps is maintained from the corona needle. Sample ions are produced by ion-molecule reactions (as described below), and pass through a small orifice or tube into the ion transfer region leading to the mass spectrometer. Various geometries of ion source are possible, depending on application. When used with liquid chromatography, particularly at higher flow rates, the nebulizer is often positioned orthogonal to (or at a similarly steep angle to) the inlet of the mass spectrometer, so that solvent and neutral material does not contaminate the actual inlet of the mass spectrometer.
The statement contradicted Parnell's assertion that the Office of Strategic Capital does not take equity stakes in private companies. The office, established in 2022 under defense secretary Lloyd Austin to lend to firms supplying the defense industrial base, reports to deputy defense secretary Stephen A. Feinberg, who approves its transactions, and its lending authority had grown from $1 billion to $100 billion. Jack Reed, the ranking Democrat on the Senate Armed Services Committee, called the effort "a blatant abuse of power and taxpayer dollars" and demanded a full accounting of its legal authority and financial terms.
Mirubactin is a siderophore produced by the bacterium Actinosynnema mirum. A. mirum was first isolated from the Raritan River in New Jersey in 1976, and its full genome sequence was published in 2009. In 2012, mirubactin was isolated and characterized, and the biosynthesis was connected with the gene cluster Amir_2714-Amir_2728, since renamed mrbA-mrbO.
=== Anxiety disorders === KOR antagonists have demonstrated anxiolytic efficacy in preclinical stress models and early clinical evaluation. Early generation antagonists such as JDTic and nor-BNI produced anxiolytic-like effects in GAD, PTSD, and panic disorder models. However their long duration of action and off-target toxicities limited clinical development. Contemporary short-acting antagonists such as aticaprant are being evaluated for anxiety indications given their improved pharmacokinetic profiles and reduced toxicity burden.
Sources: en.wikipedia.org
== Origins == The word metabolome appears to be a blending of the words "metabolite" and "chromosome". It was constructed to imply that metabolites are indirectly encoded by genes or act on genes and gene products. The term "metabolome" was first used in 1998 and was likely coined to match with existing biological terms referring to the complete set of genes (the genome), the complete set of proteins (the proteome) and the complete set of transcripts (the transcriptome). The first book on metabolomics was published in 2003. The first journal dedicated to metabolomics (titled simply "Metabolomics") was launched in 2005 and is currently edited by Prof. Roy Goodacre. Some of the more significant early papers on metabolome analysis are listed in the references below.
== Terminology == Eras cannot easily be defined for periodization, the process of categorizing the past into quantified, named blocks of time for the purpose of analysis. 1500 is an approximate starting period for the modern era because many major events caused the Western world to change around then: from the fall of Constantinople (1453), Gutenberg's moveable type printing press (1450s), and Christopher Columbus's voyage to the Americas (1492), to the Reformation begun with Martin Luther's Ninety-five Theses (1517). The term "modern" was coined shortly before 1585 to describe the beginning of a new era. It was long thought that the term "early modern" was invented either in the 1930s, to distinguish the time between the Middle Ages and late Enlightenment (1800), or the mid-20th century, and only gained traction in the 1960s. Justus Nipperdey pointed to its widespread usage by American historians around 1900 already, adding: 'In the interwar years the term permeated all areas of professional activity from textbooks and graduate school seminars to conferences, research articles, and job descriptions.' The difference between "early modern" and "modern" was defined by the French Revolution and Industrial Revolution. The European Renaissance (14th–16th centuries), which started in Italy, is an important transition period beginning in the Late Middle Ages and marking the change into early modern history.
== Chain Home, Chain Home Low, Chain Home Extra Low, ROTOR and tropo-scatter stations == Notes: Some of the Chain Home Low sites were co-located with the larger Chain Home radars. Chain Home Extra Low equipment was co-located with "Chain Home" and "Chain Home Low" as well as at separate sites, but were of a less permanent nature, usually with mobile equipment. ROTOR was the post war Radar interception system created from existing radar installations. NARS, the North Atlantic Radio System, was an extension of the US Distant Early Warning system tropo-scatter communications network. ACE High provided long-range communications for NATO.
Sources: en.wikipedia.org
=== Prime Ministers === Prime Minister for Bosnia and Herzegovina (part of Yugoslav Government) Rodoljub Čolaković (7 March 1945 – 27 April 1945) Prime Ministers Rodoljub Čolaković (27 April 1945 – September 1948) Đuro Pucar (September 1948 – March 1953) Chairmen of the Executive Council Đuro Pucar (March 1953 – December 1953) Avdo Humo (December 1953 – 1956) Osman Karabegović (1956–1963) Hasan Brkić (1963–1965) Rudi Kolak (1965–1967) Branko Mikulić (1967–1969) Dragutin Kosovac (1969 – April 1974) Milanko Renovica (April 1974 – 28 April 1982) Seid Maglajlija (28 April 1982 – 28 April 1984) Gojko Ubiparip (28 April 1984 – April 1986) Josip Lovrenović (April 1986 – April 1988) Marko Ceranić (April 1988 – 20 December 1990) Jure Pelivan (20 December 1990 – 8 April 1992)
A functional graphene integrated circuit was demonstrated—a complementary inverter consisting of one p- and one n-type transistor. However, this inverter suffered from low voltage gain. Typically, the amplitude of the output signal is about 40 times less than that of the input signal. Moreover, none of these circuits operated at frequencies higher than 25 kHz. In the same year, tight-binding numerical simulations demonstrated that the band-gap induced in graphene bilayer field effect transistors is not sufficiently large for high-performance transistors for digital applications, but can be sufficient for ultra-low voltage applications, when exploiting a tunnel-FET architecture. In February 2010, researchers announced graphene transistors with an on-off rate of 100 gigahertz, far exceeding prior rates, and exceeding the speed of silicon transistors with an equal gate length. The 240 nm devices were made with conventional silicon-manufacturing equipment. According to a January 2010 report, graphene was epitaxially grown on SiC in a quantity and with quality suitable for mass production of integrated circuits. At high temperatures, the quantum Hall effect could be measured. IBM built 'processors' using 100 GHz transistors on 2-inch (51 mm) graphene sheets. In June 2011, IBM researchers announced the first graphene-based wafer-scale integrated circuit, a broadband radio mixer. The circuit handled frequencies up to 10 GHz. Its performance was unaffected by temperatures up to 127 °C. In November researchers used 3D printing (additive manufacturing) to fabricate devices.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
The lyophilized solid is normally held at 2 to 8 °C in a sealed, light-protected container. Dry storage limits both hydrolysis and microbial growth. Material kept this way remains stable for the shelf life stated by the supplier.
Reverse-phase HPLC separates the peptide from related impurities and yields a purity estimate. Mass spectrometry confirms the expected molecular mass and flags sequence errors. The two techniques are commonly reported together on a certificate of analysis.
Short exposure during handling is not considered a major problem for the dry powder. Prolonged storage at ambient temperature, especially of reconstituted solutions, raises the risk of degradation. Cold storage remains the standard practice for longer periods.
Thymosin fraction 5 is a mixture of many peptides obtained from thymus tissue, while thymosin alpha 1 is a single defined 28-residue molecule. The two names appear together in older literature because the purified peptide was first obtained from that mixture.